DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and P58IPK

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster


Alignment Length:274 Identity:67/274 - (24%)
Similarity:101/274 - (36%) Gaps:85/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EAQRCIDFAVQALAA----GKIEKAEKFLLKAERLFPTDNAKKLLAQ----LKSTPSN-----ES 58
            |.:.|:.|..:....    .|:.|.||.|:.||:.....:..:.:|.    |::.|..     |.
  Fly   247 EIRECLKFDPEHKLCFPFYKKLRKVEKQLVNAEQAREEKHFAECIAAGEAVLRNEPEETMIRYEG 311

  Fly    59 NGKSRTAGASDE----------------KDSGPRKRVNSD----------------SRSSAPDYT 91
            :....|....||                ||:    :|..|                |..:|.|..
  Fly   312 HKVLCTCYTGDEQFGKALQQCKEALDIMKDA----QVYCDRADALLGTEMYDDAIHSFQAALDLE 372

  Fly    92 KDQLEAVRKVKTCK---------DYYEVLGVSKTATDSEIKKAYKKLALQLHPDK---NKAPGAV 144
            :....|...::..|         |||::|||.::|:..||.|||:|.|.:.|||.   .:...|.
  Fly   373 ESNTRAKEGIQRAKKLQKQSERRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAE 437

  Fly   145 EAFKALGNAAGVLTDAEKRKNYDLYGINESHNG------HGNNGGGHHGHGQYYNNEYGYSRGFQ 203
            :.|..:..|..||||.|||:.:|        ||      ..|..||.||...:.:.::|  ..||
  Fly   438 KKFIDIAAAKEVLTDPEKRRQFD--------NGEDPLDPESNQRGGFHGEHPFGHFQHG--SPFQ 492

  Fly   204 ADISAEELFNMFFN 217
                    |...||
  Fly   493 --------FKFHFN 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 42/131 (32%)
DnaJ 106..167 CDD:278647 27/63 (43%)
DUF1977 269..366 CDD:286411
P58IPKNP_649916.1 TPR_11 42..108 CDD:290150
TPR repeat 43..71 CDD:276809
TPR repeat 76..106 CDD:276809
TPR_11 78..142 CDD:290150
TPR repeat 111..139 CDD:276809
TPR_1 113..144 CDD:278916
TPR_19 167..234 CDD:291240
TPR repeat 190..220 CDD:276809
TPR repeat 225..253 CDD:276809 2/5 (40%)
TPR repeat 309..337 CDD:276809 4/27 (15%)
TPR_11 312..373 CDD:290150 10/64 (16%)
TPR repeat 341..371 CDD:276809 5/33 (15%)
TPR repeat 376..399 CDD:276809 4/22 (18%)
DnaJ 395..>485 CDD:223560 35/97 (36%)
DnaJ 396..460 CDD:278647 27/63 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.