DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3061 and CG7130

DIOPT Version :9

Sequence 1:	NP_650328.1	Gene:	CG3061 / 41707	FlyBaseID:	FBgn0038195	Length:	370	Species:	Drosophila melanogaster
Sequence 2:	NP_649380.1	Gene:	CG7130 / 40450	FlyBaseID:	FBgn0037151	Length:	128	Species:	Drosophila melanogaster

Alignment Length:	66	Identity:	31/66 - (46%)
Similarity:	46/66 - (69%)	Gaps:	0/66 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||||::||:.:.|:..::||.|:::||:.|||||..|.|.|.|:.:..|..||.|.|||:.||.:
  Fly     3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQH 67

  Fly   170 G 170
            |
  Fly    68 G 68

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3061	NP_650328.1	DnaJ	105..>224	CDD:223560	31/66 (47%)
		DnaJ	106..167	CDD:278647	27/60 (45%)
		DUF1977	269..366	CDD:286411
CG7130	NP_649380.1	DnaJ	4..65	CDD:278647	27/60 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45458956
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	2.740