DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnajb6b

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_009301640.1 Gene:dnajb6b / 393275 ZFINID:ZDB-GENE-040426-1122 Length:311 Species:Danio rerio


Alignment Length:298 Identity:89/298 - (29%)
Similarity:125/298 - (41%) Gaps:90/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPG----AVEAFKALGNAAGVLTDAEKRKN 165
            :|||.:|||:|:|:..:|||||:||||:.|||||  |.    |.:.||.:..|..||:|..||::
Zfish     3 EDYYHILGVTKSASPDDIKKAYRKLALKWHPDKN--PNDKEEAEKRFKEISEAYEVLSDENKRRD 65

  Fly   166 YDLYGINESHNGHGNNGGGHHGHGQYYNNEY--GYS--------RGF------QADISAEELFNM 214
            ||.||    ..|..|.||       :|::||  |::        |.|      .||..|::.|..
Zfish    66 YDRYG----KQGLSNRGG-------HYDDEYMGGFTFRNPEDVFREFFGGHDPFADFFADDTFEG 119

  Fly   215 FFNGGFPQQNVHMRQQRRRQQAREDREG-----------NNSSALVNLLPIVLLIGLSMMSSFFI 268
            ||.|           :|.|..:|....|           :.|.......|...:.|.|..|  |.
Zfish   120 FFGG-----------RRHRGMSRSRTAGPFFPGFSPFGPSFSGFDTGFSPFGPMGGGSFSS--FS 171

  Fly   269 SDP---------MYSLTPSHKY-SVKRETNSLKVPYYVKDNFYSEYQGSVARLEESVEED----- 318
            |.|         ..|::.|.|: :.||.|....|            :....|:|  ||||     
Zfish   172 SSPFGGGGGMRNFTSISTSTKFINGKRITTKRIV------------ENGQERVE--VEEDGQLKS 222

  Fly   319 -FVNHLKHSCSRERNYRDSMLAKARTFGDRDLYRKAQN 355
             .||.:... |.||..::::...|.  .:|.|...|||
Zfish   223 LTVNAISDD-SEERRRQNTLCGPAP--HNRYLRNVAQN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 53/138 (38%)
DnaJ 106..167 CDD:278647 32/64 (50%)
DUF1977 269..366 CDD:286411 26/103 (25%)
dnajb6bXP_009301640.1 DnaJ 4..67 CDD:278647 32/64 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.