DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and DnaJ-1

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:117 Identity:52/117 - (44%)
Similarity:70/117 - (59%) Gaps:4/117 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||:|::||:.:.|:|.||||||:||||:.||||||:|.|.|.||.:..|..||:|.:||..:|.|
  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67

  Fly   170 GINESHNGH-GNNGGGHHGHGQYYNNEYGYSRG-FQADISAEELFNMFFNGG 219
            |.:....|. |.:|||.  .|.|....:|..|. |.....:.:.|..||.||
  Fly    68 GEDGLKGGQPGPDGGGQ--PGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGG 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 51/116 (44%)
DUF1977 264..364 CDD:462754
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 51/116 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.