DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and DNAJB13

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:110 Identity:34/110 - (30%)
Similarity:52/110 - (47%) Gaps:20/110 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 TATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGINESHNGHGN 180
            ||.|.:  :.|::|||:.||.|:..|.:.|.|:.:..|..||:|..||..||.:|      ..|.
Human    50 TAEDKD--QRYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFG------EEGL 106

  Fly   181 NGGGHHGHGQYYNNEYG----YSRGFQADISAEELFNMFFNGGFP 221
            .||        ...|:|    ::.|:......|::|:.||.|..|
Human   107 KGG--------IPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 34/110 (31%)
DnaJ 106..167 CDD:278647 19/50 (38%)
DUF1977 269..366 CDD:286411
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 34/110 (31%)
DnaJ 48..99 CDD:278647 19/50 (38%)
DnaJ_C 174..336 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.