powered by:
Protein Alignment CG3061 and Dnajc11
DIOPT Version :9
Sequence 1: | NP_650328.1 |
Gene: | CG3061 / 41707 |
FlyBaseID: | FBgn0038195 |
Length: | 370 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102164.1 |
Gene: | Dnajc11 / 362666 |
RGDID: | 1307731 |
Length: | 559 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 27/70 - (38%) |
Similarity: | 41/70 - (58%) |
Gaps: | 4/70 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAP----GAVEAFKALGNAAGVLTDAEKRKN 165
:|||.:|.|.:.|:..|:|.||::|.:..||||::.| .|...|..:..|..||:|.:.|..
Rat 13 EDYYSLLNVRREASAEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAI 77
Fly 166 YDLYG 170
||:||
Rat 78 YDIYG 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.