DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajc11

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001102164.1 Gene:Dnajc11 / 362666 RGDID:1307731 Length:559 Species:Rattus norvegicus


Alignment Length:70 Identity:27/70 - (38%)
Similarity:41/70 - (58%) Gaps:4/70 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAP----GAVEAFKALGNAAGVLTDAEKRKN 165
            :|||.:|.|.:.|:..|:|.||::|.:..||||::.|    .|...|..:..|..||:|.:.|..
  Rat    13 EDYYSLLNVRREASAEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAI 77

  Fly   166 YDLYG 170
            ||:||
  Rat    78 YDIYG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 27/70 (39%)
DnaJ 106..167 CDD:278647 23/64 (36%)
DUF1977 269..366 CDD:286411
Dnajc11NP_001102164.1 DnaJ 14..79 CDD:278647 23/64 (36%)
Selenoprotein_S 372..>447 CDD:284376
DUF3395 417..549 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.