DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajc16

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001014216.1 Gene:Dnajc16 / 362652 RGDID:1359395 Length:771 Species:Rattus norvegicus


Alignment Length:217 Identity:69/217 - (31%)
Similarity:92/217 - (42%) Gaps:66/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYG 170
            |.|.|||||:||:.::|||||||||.:.||||||.|||.:.|..:..|..:|::.|||.|||.||
  Rat    29 DPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDKFIQISKAYEILSNEEKRTNYDHYG 93

  Fly   171 INESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMF-FNGGFPQQNVHMRQQRRRQ 234
                      :.|.:.|:.|  ..||.: |.|..:...:|.|..| ||            ..||.
  Rat    94 ----------DAGENQGYQQ--QREYRF-RHFHENFYFDESFFHFPFN------------SERRD 133

  Fly   235 QAREDREGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYSLTPSHKYSVKRETNSLKVPYYVKDN 299
            ..                                 |..|.|..|| |..:...:|.|.||.:|  
  Rat   134 SI---------------------------------DEKYLLHFSH-YVNEVVPDSFKKPYLIK-- 162

  Fly   300 FYSEYQGSVARLE----ESVEE 317
            ..|::..|...:|    |.|:|
  Rat   163 ITSDWCFSCIHIEPIWKEVVQE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 50/118 (42%)
DnaJ 106..167 CDD:278647 34/60 (57%)
DUF1977 269..366 CDD:286411 17/53 (32%)
Dnajc16NP_001014216.1 DnaJ 29..90 CDD:278647 34/60 (57%)
TRX_DnaJ 133..242 CDD:239261 17/88 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.