DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajb11

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001015021.1 Gene:Dnajb11 / 360734 RGDID:1307373 Length:358 Species:Rattus norvegicus


Alignment Length:312 Identity:83/312 - (26%)
Similarity:130/312 - (41%) Gaps:63/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN-KAPGAVEAFKALGNAAGVLTDAEKRKNYDL 168
            :|:|::|||.::|:..:|||||:|||||||||:| ..|.|.|.|:.||.|..||:|:||||.||.
  Rat    24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDT 88

  Fly   169 YGINESHNGHGNNGGGHHGHGQYYNNEYGY-------------SRGFQADISAEELFNMFFNGGF 220
            ||.....:||.::.|....|   :..::|:             .||....:..|......:.|.|
  Rat    89 YGEEGLKDGHQSSHGDIFSH---FFGDFGFMFGGAPRQQDRNIPRGSDIIVDLEVTLEEVYAGNF 150

  Fly   221 PQ--------------QNVHMRQQRRRQQAREDREGNNSSALVNLLPIVLLIG----LSMMSSFF 267
            .:              :..:.||:.|..|....|.......:.:..|.|.|:.    |.:.....
  Rat   151 VEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPG 215

  Fly   268 ISDPM-YSLTPSHKYSVKRETNSLKVPYYVK-----------DNFYSEYQGSVARLEESVEEDFV 320
            :.|.| |......:..|..|...|:  :.:|           |:.|:....|:.......|.| :
  Rat   216 VRDGMEYPFIGEGEPHVDGEPGDLR--FRIKVVKHRIFERRGDDLYTNVTVSLVEALVGFEMD-I 277

  Fly   321 NHL---KHSCSRERNYRDSMLAKARTFGDRDLYRKAQNINTPSCENLQKYLI 369
            .||   |...||::..|..  ||        |::|.:.:......|::..||
  Rat   278 THLDGHKVHISRDKITRPG--AK--------LWKKGEGLPNFDNNNIKGSLI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 49/146 (34%)
DnaJ 106..167 CDD:278647 35/61 (57%)
DUF1977 269..366 CDD:286411 23/111 (21%)
Dnajb11NP_001015021.1 DnaJ 22..344 CDD:223560 83/312 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.