DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and DnaJ-H

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster


Alignment Length:132 Identity:45/132 - (34%)
Similarity:67/132 - (50%) Gaps:15/132 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGIN 172
            |:||.|:..|||.||||.|:|||.:.|||||  |.|.:.||.:..|..||:|.|||:.||.||:.
  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69

  Fly   173 ESHNGHGNNGGGHHGHGQYYNNEYGYSRG---------FQADISAEELFNMFFNGGFPQQNVHMR 228
            ....|............|::..:...|.|         .:.:::.||:    :.||..::..:.|
  Fly    70 GLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEI----YVGGMKKKVEYNR 130

  Fly   229 QQ 230
            |:
  Fly   131 QK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 43/124 (35%)
DnaJ 106..167 CDD:278647 31/58 (53%)
DUF1977 269..366 CDD:286411
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 45/132 (34%)
DnaJ 5..64 CDD:278647 31/58 (53%)
DnaJ_C 106..329 CDD:199909 6/31 (19%)
DnaJ_zf 134..197 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.