DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and CG5001

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_608586.2 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster


Alignment Length:170 Identity:61/170 - (35%)
Similarity:84/170 - (49%) Gaps:39/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||||::||:.|||||.||||||:||||:.|||||||..|.:.||.:..|..||:|..||:.||.|
  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67

  Fly   170 GINESHNGHGNNGG------GHHGHG-------QYYNNEYGYSRGFQA----------DISAE-E 210
            |.:...:|...|||      .:..||       |::.|...::..|..          |:..| :
  Fly    68 GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPD 132

  Fly   211 LFNMFFNG---------GFPQQ------NVHMRQQRRRQQ 235
            .|:..|.|         ||...      |||...::.::|
  Fly   133 FFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 54/146 (37%)
DUF1977 264..364 CDD:462754
CG5001NP_608586.2 DnaJ_bact 4..347 CDD:274090 60/169 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.