DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and shv

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster


Alignment Length:131 Identity:50/131 - (38%)
Similarity:69/131 - (52%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNK-APGAVEAFKALGNAAGVLTDAEKRKNYDL 168
            :|:|::|.|.|.|..:|:||||::||.:||||||| .|.|...|:.||.|..||::.:|||.||.
  Fly    24 RDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYDR 88

  Fly   169 YGINE--SHNGHGNNGG----------GHH--GHGQYYNNEYGYSRGFQADISAEELFNMFFNGG 219
            .| .|  ...|..::||          |.|  |.||..:...|........:|.|||    ::|.
  Fly    89 CG-EECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMDLYVSLEEL----YSGN 148

  Fly   220 F 220
            |
  Fly   149 F 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 49/128 (38%)
DUF1977 264..364 CDD:462754
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 50/130 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.