DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnajc5ga

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_955917.1 Gene:dnajc5ga / 322863 ZFINID:ZDB-GENE-030131-1583 Length:199 Species:Danio rerio


Alignment Length:101 Identity:44/101 - (43%)
Similarity:56/101 - (55%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RKVKTCKD-YYEVLGVSKTATDSEIKKAYKKLALQLHPDKN-KAPGAVEAFKALGNAAGVLTDAE 161
            ||:.|..| .|:|||:.|.||..:||:||:||||:.||||| ..|.|.|.||.:.||..:|||..
Zfish    13 RKMSTTGDSLYKVLGLEKGATAEDIKRAYRKLALKYHPDKNPDNPEAAEKFKEINNANSILTDET 77

  Fly   162 KRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYG 197
            |||.||.||                ..|.|.:.::|
Zfish    78 KRKIYDEYG----------------SMGLYVSEQFG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 41/94 (44%)
DUF1977 264..364 CDD:462754
dnajc5gaNP_955917.1 DnaJ 21..83 CDD:395170 33/61 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.