DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnaja4

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:240 Identity:69/240 - (28%)
Similarity:100/240 - (41%) Gaps:67/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AAGKIEKAEKFLLKAERLFPTDNAKKLLAQLKSTPSNESNGKSRTAG---ASDEKDSGPRKRVNS 81
            |:|:.:..::         ||...|...:..| ||:.|....:|...   :|.|.|..|.::.:.
  Rat    99 ASGRRDSRQR---------PTSTTKPESSTPK-TPATEHPNMARGGNQNWSSGESDGQPEEQTSE 153

  Fly    82 DSRSSAPDYTKDQLEAVRKVKTCKDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEA 146
            ::.......|:              ||::|||..:|:..||||||:||||:.|||||  |...|.
  Rat   154 ENGDKMVKETQ--------------YYDILGVKPSASPEEIKKAYRKLALKYHPDKN--PDEGEK 202

  Fly   147 FKALGNAAGVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEEL 211
            ||.:..|..||:|.:||..||..|......|    |.|              |..|.   |..::
  Rat   203 FKLISQAYEVLSDPKKRDIYDQGGEQAIKEG----GSG--------------SPSFS---SPMDI 246

  Fly   212 FNMFFNGGFPQQNVHMRQQRRRQQAREDREGNNSSALVNLLPIVL 256
            |:|||.||             .:..|| |.|.|   :|:.|.:.|
  Rat   247 FDMFFGGG-------------GRMTRE-RRGKN---VVHQLSVTL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 46/118 (39%)
DnaJ 106..167 CDD:278647 31/60 (52%)
DUF1977 269..366 CDD:286411
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 57/185 (31%)
DnaJ 165..223 CDD:278647 31/59 (53%)
DnaJ_C 264..490 CDD:199909 4/14 (29%)
DnaJ_zf 293..359 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.