DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajb4

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001013094.1 Gene:Dnajb4 / 295549 RGDID:1305826 Length:337 Species:Rattus norvegicus


Alignment Length:202 Identity:68/202 - (33%)
Similarity:91/202 - (45%) Gaps:40/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||||.:||:.|.|||.:|||||:|.||:.||||||:|.|.|.||.:..|..||:|.:||:.||.:
  Rat     3 KDYYHILGIEKGATDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQF 67

  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQRRRQ 234
            |    ..|.....||..|.|    ..:.|:  |..|..|  .|..||.|..|.:....|:....:
  Rat    68 G----EEGLKGGAGGTDGQG----GTFRYT--FHGDPHA--TFAAFFGGANPFEIFFGRRMGGGR 120

  Fly   235 QARE--------------------DREGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYS-LTPS 278
            .:.|                    ||.....|.|....||:..:.:|:       :.:|| .|..
  Rat   121 DSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSL-------EEIYSGCTKR 178

  Fly   279 HKYSVKR 285
            .|.|.||
  Rat   179 MKISRKR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 52/118 (44%)
DnaJ 106..167 CDD:278647 34/60 (57%)
DUF1977 269..366 CDD:286411 7/18 (39%)
Dnajb4NP_001013094.1 DnaJ 1..332 CDD:223560 68/202 (34%)
DnaJ 4..65 CDD:278647 34/60 (57%)
DnaJ_C 158..320 CDD:199909 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.