DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and DNAJB5

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens


Alignment Length:117 Identity:50/117 - (42%)
Similarity:64/117 - (54%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||||::||:...|.:.||||||:|:||:.||||||.|.|.|.||.:..|..||:|.:||..||.|
Human    75 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQY 139

  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFP 221
            |......|.|.:||.        :..:.|:  |..|..|  .|..||.|..|
Human   140 GEEGLKTGGGTSGGS--------SGSFHYT--FHGDPHA--TFASFFGGSNP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 48/113 (42%)
DUF1977 264..364 CDD:462754
DNAJB5NP_001128477.1 DnaJ_bact 76..415 CDD:274090 49/116 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.