DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and SPOM_SPCC63.13

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_587986.1 Gene:SPOM_SPCC63.13 / 2539451 PomBaseID:SPCC63.13 Length:208 Species:Schizosaccharomyces pombe


Alignment Length:119 Identity:39/119 - (32%)
Similarity:59/119 - (49%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDK---NKAPGAVEAFKALGNAAGVLTDAEKRKNY 166
            ||||.:|.::..|:..|||.||||.||:.|||:   :....|.|.|:.:..|..||:|..:|..|
pombe     3 KDYYAILNITPKASAEEIKYAYKKAALETHPDRVSPSARARATEQFQLVNEAYYVLSDNSRRAQY 67

  Fly   167 DLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQ---ADISAEELFNMFFN 217
            |....:.|.....:.....:...|..:.:.|.|.||:   :|...|::||...|
pombe    68 DRESASSSAKPRQSFFSRTNPQPQSQSQQGGPSFGFRQSFSDSQFEQVFNEMMN 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 38/118 (32%)
DUF1977 264..364 CDD:462754
SPOM_SPCC63.13NP_587986.1 DnaJ 4..68 CDD:395170 25/63 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.