DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajb6

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001365764.1 Gene:Dnajb6 / 23950 MGIID:1344381 Length:372 Species:Mus musculus


Alignment Length:118 Identity:52/118 - (44%)
Similarity:69/118 - (58%) Gaps:12/118 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEKRKNYDL 168
            ||||||||.:.|:..:|||||:|.||:.|||||  ....|...||.:..|..||:||:||..||.
Mouse     3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67

  Fly   169 YGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFP 221
            || .|..|| |..|||.|....:   |:|::  |:   :.:::|..||.|..|
Mouse    68 YG-KEGLNG-GGGGGGIHFDSPF---EFGFT--FR---NPDDVFREFFGGRDP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 52/118 (44%)
DnaJ 106..167 CDD:278647 32/62 (52%)
DUF1977 269..366 CDD:286411
Dnajb6NP_001365764.1 Interaction with HSP70. /evidence=ECO:0000250 1..147 52/118 (44%)
DnaJ 2..>138 CDD:223560 52/118 (44%)
Interaction with KRT18. /evidence=ECO:0000250 120..235
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.