DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and DNAJC18

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_689899.1 Gene:DNAJC18 / 202052 HGNCID:28429 Length:358 Species:Homo sapiens


Alignment Length:299 Identity:114/299 - (38%)
Similarity:183/299 - (61%) Gaps:32/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YTKDQLEAVRKVKTCKDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAA 154
            |:::||..|:::|.|::|||:||||:.|:|.|:||||:||||:.|||||.||||.:||||:|||.
Human    66 YSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAF 130

  Fly   155 GVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGG 219
            .||::.:||..||.|| :|.........           ..|.|.|.|:|||:.|||||:||.|.
Human   131 AVLSNPDKRLRYDEYG-DEQVTFTAPRA-----------RPYNYYRDFEADITPEELFNVFFGGH 183

  Fly   220 FPQQNVHM---------------RQQRRRQQAREDREGNNS--SALVNLLPIVLLIGLSMMSSFF 267
            ||..|:||               |.:|.:.|..|:.|...:  ||.:.|||:::::.:|:::...
Human   184 FPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLL 248

  Fly   268 ISDPMYSL--TPSHKYSVKRETNSLKVPYYVKDNFYSEYQG-SVARLEESVEEDFVNHLKHSCSR 329
            .::|.|||  ..:..|::.|||.:|:|||:|..||...|:| |:..||:::|:|::::::.||.:
Human   249 ATNPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWK 313

  Fly   330 ERNYRDSMLAKARTFGDRDLYRKAQNINTPSCENLQKYL 368
            |:..:..:...|..:.|..|.:||:::...:||.|.|.:
Human   314 EKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLI 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 60/118 (51%)
DnaJ 106..167 CDD:278647 38/60 (63%)
DUF1977 269..366 CDD:286411 33/99 (33%)
DNAJC18NP_689899.1 DnaJ 82..143 CDD:278647 38/60 (63%)
DUF1977 250..350 CDD:286411 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7603
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55696
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 1 1.000 - - FOG0001005
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43908
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2148
SonicParanoid 1 1.000 - - X535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.