DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnj-3

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_506711.1 Gene:dnj-3 / 182084 WormBaseID:WBGene00001021 Length:191 Species:Caenorhabditis elegans


Alignment Length:151 Identity:44/151 - (29%)
Similarity:58/151 - (38%) Gaps:61/151 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNK-----------APGA--VEAFKALGNAAGV 156
            |:|||::|||.:||..||:.|:.|...|||||:::           |.|:  .|.|..:..|..|
 Worm    17 KNYYEIIGVSASATRQEIRDAFLKKTKQLHPDQSRKSSKSDSRVGWATGSSETEQFMLVKEAYDV 81

  Fly   157 LTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFP 221
            |.:.||||.|||                            .:||                .|||.
 Worm    82 LRNEEKRKEYDL----------------------------AFSR----------------EGGFL 102

  Fly   222 QQNVH----MRQQRRRQQARE 238
            .:..|    |..|||..|..|
 Worm   103 MEATHKTQEMSTQRRNIQRAE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 37/131 (28%)
DnaJ 106..167 CDD:278647 28/73 (38%)
DUF1977 269..366 CDD:286411
dnj-3NP_506711.1 DnaJ_bact 19..>92 CDD:274090 28/72 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.