DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnj-26

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_502326.1 Gene:dnj-26 / 178171 WormBaseID:WBGene00001044 Length:365 Species:Caenorhabditis elegans


Alignment Length:290 Identity:70/290 - (24%)
Similarity:116/290 - (40%) Gaps:67/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RSSAPDYTKDQLEAVRKVKTCKDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFK 148
            :|:..||||:|.:.|..:..|||:|::|.|.|.|:..||:.|::|...::||||.|.|.|.||.|
 Worm     5 KSAKSDYTKEQKDLVGNICQCKDFYKILNVDKKASPDEIRIAFRKRIREVHPDKCKHPSATEASK 69

  Fly   149 ALGNAAGVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFN 213
            .:.||..:|.|..||:.|||.                                 .|:.|.|.|:.
 Worm    70 VVNNAFSLLMDPAKRRQYDLQ---------------------------------NAETSNENLYK 101

  Fly   214 MFFNGGFPQQNVHMRQQRRRQQAREDREGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYSLTPS 278
            ........::..:...||:..:..|...|..:.                .:|.|..|   ..:.:
 Worm   102 RCNRNKNQRKQEYSNTQRQNHKKSEPSNGKRNE----------------QNSSFKQD---HNSKN 147

  Fly   279 HKYSVKRETNSLKVPYYVKDNF------YSEYQGSVARLEESVE--EDFV--NHLKHSCSRERNY 333
            |:.:.::..|....||..::||      |.|.:...:....|.:  ||||  |:..:...::..|
 Worm   148 HQSNHQKTKNKKSNPYSNQNNFNNTRKDYREEKSGFSWNTGSADDYEDFVYRNYQSYQQQQQNQY 212

  Fly   334 RDSMLAKARTFGDRDLYRKAQNINTPSCEN 363
                 |:.|.....|.::.:.:.|..|..|
 Worm   213 -----ARRRHEEYTDGFKYSSSSNPHSTSN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 34/118 (29%)
DnaJ 106..167 CDD:278647 26/60 (43%)
DUF1977 269..366 CDD:286411 22/105 (21%)
dnj-26NP_502326.1 DnaJ 27..88 CDD:365959 26/60 (43%)
DUF4887 <81..174 CDD:374444 22/144 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166970
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43908
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.