DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnj-2

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_502126.1 Gene:dnj-2 / 178043 WormBaseID:WBGene00001020 Length:337 Species:Caenorhabditis elegans


Alignment Length:98 Identity:33/98 - (33%)
Similarity:45/98 - (45%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YEVLGVSKTATDSE-IKKAYKKLALQLHPD--KNKAPG--AVEAFKALGNAAGVLTDAEKRKNYD 167
            |:||.|::...|.: :.|||:.||.:.|||  |||...  |.|.|:.:..|...|.|.|.:.|||
 Worm    38 YDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNYD 102

  Fly   168 LYGINESHNGHGNNGGGHHGHGQYYNNEYGYSR 200
            .|              ..|...::| |.|.|.|
 Worm   103 YY--------------LDHPDQRFY-NYYQYYR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 33/98 (34%)
DnaJ 106..167 CDD:278647 24/63 (38%)
DUF1977 269..366 CDD:286411
dnj-2NP_502126.1 DnaJ 36..102 CDD:278647 24/63 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.