DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnj-16

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001254890.1 Gene:dnj-16 / 175540 WormBaseID:WBGene00001034 Length:395 Species:Caenorhabditis elegans


Alignment Length:260 Identity:67/260 - (25%)
Similarity:104/260 - (40%) Gaps:64/260 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GPRKRVNSDSRSSAPDYTKDQLEAVRKVKTCKDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN 138
            |.|:...:.|.:.:...|......|.::    |:|::|||.|.|:::|||.||:||||:.|||:|
 Worm     6 GKRRSSQATSATMSKATTPGDQPKVSEM----DFYQLLGVEKMASEAEIKSAYRKLALKYHPDRN 66

  Fly   139 KAPG-AVEAFKALGNAAGVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGF 202
            .... |.|.||.:..|..||:|..||:.||:.|.:|                    |:..: .||
 Worm    67 PNDAHAQEEFKKVSIAYSVLSDPNKRRQYDVSGPSE--------------------NQLDF-EGF 110

  Fly   203 QADISAEELFNMFFNGGFPQQNVHMRQQ---RRRQQAREDREGNNSSALVNLLPIVLLIGLSMMS 264
              |:|........|...|.:..|.:..|   :...|||....|.........||    .|.::.|
 Worm   111 --DVSEMGGVGRVFGALFSKLGVPIPTQIVPKVLAQARHICMGQECDVQARQLP----PGETVTS 169

  Fly   265 SFFISDPMYSLTPSHKYSV---------------KRETNSLKVPYYVKDNFYSEYQGSVARLEES 314
            |       .|...:|.|.:               |..::..|:..:.|       :|.|..::||
 Worm   170 S-------VSKQHAHFYEINIQEEHRKNGVAIICKSSSSKFKLVLFDK-------EGGVRMIQES 220

  Fly   315  314
             Worm   221  220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 41/119 (34%)
DnaJ 106..167 CDD:278647 30/61 (49%)
DUF1977 269..366 CDD:286411 10/61 (16%)
dnj-16NP_001254890.1 DnaJ 30..>127 CDD:223560 41/123 (33%)
PLN02281 297..>370 CDD:177920
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.