DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnj-12

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_493570.1 Gene:dnj-12 / 173341 WormBaseID:WBGene00001030 Length:402 Species:Caenorhabditis elegans


Alignment Length:113 Identity:47/113 - (41%)
Similarity:63/113 - (55%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 YYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGI 171
            ||:||||...|:|:|:||||:|:||:.|||||  |...|.||.:..|..||:|.:||:.|| .|.
 Worm     7 YYDVLGVKPDASDNELKKAYRKMALKFHPDKN--PDGAEQFKQISQAYEVLSDEKKRQIYD-QGG 68

  Fly   172 NESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGG 219
            .|:..|.|..|.|.|       |.:             ::|:|||.||
 Worm    69 EEALQGGGGGGEGFH-------NPF-------------DVFDMFFGGG 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 47/113 (42%)
DUF1977 264..364 CDD:462754
dnj-12NP_493570.1 PTZ00037 2..401 CDD:240236 47/113 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.