Sequence 1: | NP_650328.1 | Gene: | CG3061 / 41707 | FlyBaseID: | FBgn0038195 | Length: | 370 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491084.1 | Gene: | dnj-28 / 171870 | WormBaseID: | WBGene00001046 | Length: | 494 | Species: | Caenorhabditis elegans |
Alignment Length: | 245 | Identity: | 66/245 - (26%) |
---|---|---|---|
Similarity: | 95/245 - (38%) | Gaps: | 95/245 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 DGNKDEA-QRCI------DFAVQALAAGKIEKAEKFLLKAERLFPTDNAKKLLAQLKSTPSNESN 59
Fly 60 GKSRTAGASDEKD---SGPRKRVNSDSRSSAPDYTKDQLEAVRKVKTCKDYYEVLGVSKTATDSE 121
Fly 122 IKKAYKKLALQLHPD-------KNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGINESHNGH- 178
Fly 179 ---------GNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGG 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3061 | NP_650328.1 | DnaJ | 105..>224 | CDD:223560 | 43/132 (33%) |
DnaJ | 106..167 | CDD:278647 | 27/67 (40%) | ||
DUF1977 | 269..366 | CDD:286411 | |||
dnj-28 | NP_491084.1 | TPR_11 | 23..89 | CDD:290150 | |
TPR repeat | 28..52 | CDD:276809 | |||
TPR_1 | <31..56 | CDD:278916 | |||
TPR repeat | 57..87 | CDD:276809 | |||
TPR_9 | 78..136 | CDD:290108 | |||
TPR repeat | 92..116 | CDD:276809 | |||
TPR_11 | 174..240 | CDD:290150 | |||
TPR repeat | 175..203 | CDD:276809 | |||
TPR repeat | 208..238 | CDD:276809 | |||
TPR repeat | 291..321 | CDD:276809 | 7/15 (47%) | ||
TPR_11 | 294..356 | CDD:290150 | 17/89 (19%) | ||
TPR repeat | 326..352 | CDD:276809 | 8/64 (13%) | ||
DnaJ | 378..>445 | CDD:223560 | 27/69 (39%) | ||
DnaJ | 380..445 | CDD:278647 | 27/67 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |