DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and DNAJB7

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_660157.1 Gene:DNAJB7 / 150353 HGNCID:24986 Length:309 Species:Homo sapiens


Alignment Length:283 Identity:79/283 - (27%)
Similarity:106/283 - (37%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEKRKNYDL 168
            |||||||:.:.|:..:|||||.|:||:.|||||  ....|...||.:..|..||::.|||..||.
Human     3 DYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDK 67

  Fly   169 YGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAE-----ELFNMFFNGGFPQQNVHMR 228
            ||.      .|.||||.|...:.   |||::.....|:..|     :.|:..|   |......:.
Human    68 YGT------EGLNGGGSHFDDEC---EYGFTFHKPDDVFKEIFHERDPFSFHF---FEDSLEDLL 120

  Fly   229 QQRRRQQAREDREGNNSSALVNLLPIVLLI----------------GLSMMSSFFIS----DPMY 273
            .:........:|:.....:..:..||....                ||:..||....    |...
Human   121 NRPGSSYGNRNRDAGYFFSTASEYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFDNSGMDNYI 185

  Fly   274 SLTPSHKYSVKRETNSLKV-----PYYVKDN----FYSEYQGSVARLEESVEEDFVNHLKHSCSR 329
            |:|.|.|....|..|:.|:     ....:||    |:  ...|||.     ||.|..........
Human   186 SVTTSDKIVNGRNINTKKIIESDQEREAEDNGELTFF--LVNSVAN-----EEGFAKECSWRTQS 243

  Fly   330 ERNY----RDSMLAKARTFGDRD 348
            ..||    ..|......||.|.|
Human   244 FNNYSPNSHSSKHVSQYTFVDND 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 48/124 (39%)
DnaJ 106..167 CDD:278647 30/62 (48%)
DUF1977 269..366 CDD:286411 24/97 (25%)
DNAJB7NP_660157.1 DnaJ 2..>101 CDD:223560 45/106 (42%)
DnaJ 3..66 CDD:278647 30/62 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.