DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Csp

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_061502066.1 Gene:Csp / 1269608 VectorBaseID:AGAMI1_006864 Length:244 Species:Anopheles gambiae


Alignment Length:120 Identity:45/120 - (37%)
Similarity:57/120 - (47%) Gaps:29/120 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RKVKTCKD-YYEVLGVSKTATDSEIKKAYKKLALQLHPDKN-KAPGAVEAFKALGNAAGVLTDAE 161
            ||:.|..| .|:.||:.||||..||||.|:||||:.||||| ..|.|.:.||.:..|..:|:|..
Mosquito     4 RKLSTSGDTLYQTLGLQKTATADEIKKTYRKLALKYHPDKNPNNPDAADKFKEVNRAHSILSDLT 68

  Fly   162 KRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFF 216
            ||..||.||                ..|.|...::|           ||..|.:|
Mosquito    69 KRNIYDNYG----------------SLGLYIAEQFG-----------EENVNAYF 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 42/113 (37%)
DUF1977 264..364 CDD:462754
CspXP_061502066.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.