DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and zgc:152986

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001275586.1 Gene:zgc:152986 / 101884054 ZFINID:ZDB-GENE-061013-762 Length:177 Species:Danio rerio


Alignment Length:176 Identity:54/176 - (30%)
Similarity:74/176 - (42%) Gaps:47/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYG 170
            |||.|||||:..:..:||||:.||||:.|||||:.|.|.:.|..:..|..||:|.|||:.||   
Zfish    22 DYYSVLGVSRFVSSRDIKKAFHKLALKHHPDKNQTPNAQQTFTHIAQAYEVLSDREKRRVYD--- 83

  Fly   171 INESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFN-GGFPQQNVHMRQQRRRQ 234
             ...|               ..|.:.|..|..:.|.:.:...|:|.| |.|        |.::..
Zfish    84 -QMDH---------------LSNPDQGSERMVKKDQTEDMGSNLFSNKGSF--------QSKKSF 124

  Fly   235 QAREDREGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYSLTPSHK 280
            |.....|              ||..|.|...||:.:     .|.|:
Zfish   125 QHFSLEE--------------LLHTLQMDDDFFMGE-----QPGHE 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 43/118 (36%)
DnaJ 106..167 CDD:278647 31/60 (52%)
DUF1977 269..366 CDD:286411 2/12 (17%)
zgc:152986NP_001275586.1 DnaJ 22..83 CDD:278647 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.