DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d5 and CYP72C1

DIOPT Version :9

Sequence 1:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:296 Identity:58/296 - (19%)
Similarity:104/296 - (35%) Gaps:65/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIGIYLLI-----AAVTLLYVYLKWTFSYWDRKGFPSTGVSIPFGAL------------------ 42
            :||..:||     .||..:::..|....|..::||......|..|.:                  
plant    12 LIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLD 76

  Fly    43 ------------ESVTK-GKRSFGMAIYDMYKSTKEPVIGLYLTLRPALLVRDAQLAHDVLVKDF 94
                        .:|.| ||:.|  ..|..|.:.        :.:.|..| |:....|::..|..
plant    77 ADFLPRMMPFLHHTVLKHGKKCF--TWYGPYPNV--------IVMDPETL-REIMSKHELFPKPK 130

  Fly    95 ASFHDRGVYVDEKNDPMSASLFQMEGASWRALRNKLTPSFTSGKLKAMFETSDSVGDKLVDSIRK 159
            ...|         |....:.|...||..|...|:.|.|:|....||::....:|...::::...:
plant   131 IGSH---------NHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWER 186

  Fly   160 QLPANGAKELELKKLMATYAIDIIATTIFGLDVDSFADPNNEFQIISKKVNRNNIEDIIRGTSSF 224
            ...|.|..||:..........:::|...||   ||:.|....|:|..::::..     :....:.
plant   187 LASAKGTMELDSWTHCHDLTRNMLARASFG---DSYKDGIKIFEIQQEQIDLG-----LLAIRAV 243

  Fly   225 LYPGLEKFFVKIGWKQEATER-MRELSNRTVDLREQ 259
            ..||.:....|...:...||| ||.:....::.:|:
plant   244 YIPGSKFLPTKFNRRLRETERDMRAMFKAMIETKEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 39/195 (20%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.