DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d5 and CYP71A27

DIOPT Version :9

Sequence 1:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:428 Identity:96/428 - (22%)
Similarity:174/428 - (40%) Gaps:111/428 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PVIGLYLTLRPALLVRDAQLAHDVLVKDFASFHDR------GVYVDEKNDPMSASLFQMEGASWR 124
            |::.|:....|.|:|....:.:|::......|.:|      .::::...|    .:|...|..|:
plant    66 PLMLLHFGRVPVLVVSCPDVTNDIMKTHDLKFANRPKSKAINIFMEGGRD----IIFGPYGEDWK 126

  Fly   125 A---------LRNKLTPSFTS---GKLKAMFETSDSVGDKLVDSIRKQLPANGAKELELKKLMAT 177
            :         |.||:..||.:   .::|.|.|       ||.::      ::.:..:.|.||:.|
plant   127 SMKSLGVVHLLNNKMVRSFENLREEEIKVMTE-------KLEEA------SSSSSSVNLSKLLMT 178

  Fly   178 YAIDIIATTIFGLDVDSFADPNNEFQIISKKVNRN----NIEDIIRGTSSFLYPGLEKFF----- 233
            ...|||.....|                 :|.|..    :|::::..:|.|    ..|||     
plant   179 LTNDIICRITLG-----------------RKYNEEEGGIDIKNLVMTSSEF----FGKFFFGDFI 222

  Fly   234 ---VKIGWKQEATERMRELSNRT---VDLREQNNI-----VRKDLLQLLLQLRNQGKINTDDNIW 287
               ..|.|.....::|::::|:.   :|...|.::     ...|.:.:||.::.           
plant   223 PSLAWIDWISGIDDKMKDINNKLDCFLDSMVQEHVDADHKEPSDFIDMLLLIQK----------- 276

  Fly   288 SAESTKNGVKSMSKDLIAGQLFLFYVAGYETTASTTSFTLYELTQNPEVMEKAKEDVRSAIEKHG 352
              :.||. .|....|||.....:|: :|..||||...:|:.||.::||.|:|.::::.| ...|.
plant   277 --DKTKR-FKFDRSDLILILKDMFF-SGTATTASQLEWTMTELMRHPECMKKLQDEINS-FSTHN 336

  Fly   353 GKLTYDAISDMKYLEACILETARKYPALPLLNRICTKDYPVPDSKLVIQKGTPIIISLIGMHRDE 417
            ..:|...:..|.||...|.|..|.:|:.|||.|:.::|..:....  |..||.:||:...:.|:.
plant   337 LNVTEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQLKGYD--ISAGTHVIINAWALQRNP 399

  Fly   418 EYFP-DPLAYKPER----------------YLENGKDY 438
            ..:. |...|:|||                :||.|:|:
plant   400 AIWGLDANEYRPERHFGTNLDFNVLIPNSFHLEQGEDF 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 96/428 (22%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 96/428 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.