DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d5 and CYP72A14

DIOPT Version :9

Sequence 1:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_188086.1 Gene:CYP72A14 / 820696 AraportID:AT3G14680 Length:512 Species:Arabidopsis thaliana


Alignment Length:455 Identity:111/455 - (24%)
Similarity:195/455 - (42%) Gaps:75/455 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PALLVRDAQLAHDVL--VKDFASFHDRGVYVDEKNDPMS----ASLFQMEGASWRALRNKLTPSF 134
            |.:.:.|.:...:|.  |.||...|         ..|:|    ..|...:|..|...|..:.|:|
plant   104 PTITIMDPEQIKEVFNKVYDFQKAH---------TFPLSKILGTGLVSYDGDKWAQHRRIINPAF 159

  Fly   135 TSGKLKAMFET-----SDSVG--DKLVDSIRKQLPANGAKELELKKLMATYAIDIIATTIFGLDV 192
            ...|:|.|...     |:.||  ||||..      ...:.|:::...:.:...|:|:.|.||   
plant   160 HLEKIKNMVHVFHESCSELVGEWDKLVSD------KGSSCEVDVWPGLTSMTADVISRTAFG--- 215

  Fly   193 DSFADPNNEFQIISKKVNRNNIEDIIRGTSSFLYPGLEKFFVKIGWK---------QEATERMRE 248
            .|:.:.:..|::.::..     :.:::....|..||    ::.:..|         :|..:.:|.
plant   216 SSYREGHRIFELQAELA-----QLVMQAFQKFFIPG----YIYLPTKGNRRMKTAAREIQDILRG 271

  Fly   249 LSNRTVDLREQNNIVRKDLLQLLLQLRNQGKINTDDNIWSAESTKNGVKSMSKDLIAGQLFLFYV 313
            :.|:....||......:|||.:||: .|.|:  |:.|..|.|......|            |||:
plant   272 IINKRERARESGEAPSEDLLGILLE-SNLGQ--TEGNGMSTEDMMEECK------------LFYL 321

  Fly   314 AGYETTASTTSFTLYELTQNPEVMEKAKEDVRSAIEKHGGKL-TYDAISDMKYLEACILETARKY 377
            ||.|||:....:|:..|:|:.:...:|:|:|:...   |.|. ..:.::.:|.:...:.|..|.|
plant   322 AGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVF---GDKQPDTEGLNQLKVMTMILYEVLRLY 383

  Fly   378 PALPLLNRICTKDYPVPDSKLVIQKGTPIIISLIGMHRDEEYF-PDPLAYKPERYLENGKDYT-- 439
            |.:..|.|...|:..:.|  |.:..|..|.:.::.:|||.|.: .|...:||||:.:.....|  
plant   384 PPVVQLTRAIHKEMKLGD--LTLPGGVQISLPVLLVHRDTELWGNDAGEFKPERFKDGLSKATKN 446

  Fly   440 QAAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLEIRKEKCEIEFGVYGIPLMPKSGVPVRL 504
            |.::.||..|||:|||.....:..|:|::.:|..|..|:........:.:  |.|.|:.|..:.|
plant   447 QVSFFPFAWGPRICIGQNFTLLEAKMAMSLILQRFSFELSPSYVHAPYTI--ITLYPQFGAHLML 509

  Fly   505  504
            plant   510  509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 105/427 (25%)
CYP72A14NP_188086.1 p450 24..512 CDD:299894 111/455 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.