DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d5 and Cyp12a5

DIOPT Version :9

Sequence 1:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster


Alignment Length:450 Identity:108/450 - (24%)
Similarity:187/450 - (41%) Gaps:95/450 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DFASFHDRGVYVDEKNDPMSASLFQMEGASWRALRNKLTPSFTSGK-LKAMFETSDSVGDKLVDS 156
            |...:| |.||..:..|.:. .:...:|.||...|:.:.|.....| ::..|:....|..:.|:.
  Fly   126 DILRYH-RTVYRKDFFDGVQ-GIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVEL 188

  Fly   157 IR-------KQLPANGAKELELKKLMATYAIDIIA-TTIFGLDVDSFADPNNEFQIISKKVNRNN 213
            |:       :::|.|   .||........::.::| ....||..:|  ..|:|...:.|.::   
  Fly   189 IKEIRDASTQEVPGN---FLETINRWTLESVSVVALDKQLGLLRES--GKNSEATKLFKYLD--- 245

  Fly   214 IEDIIRGTSSFLYPGLEKFF-----------------VKIGWKQEATERMRELSNRTVDLREQNN 261
             |..:......:.|.|.::|                 |.:.:..||.||:.:.:...|...|...
  Fly   246 -EFFLHSADLEMKPSLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQ 309

  Fly   262 IVRKDLLQLLLQLRNQGKINTDDNIWSAESTKNGVKSMSKDLIAGQLFLFYVAGYETTASTTSFT 326
            .|.:.||::                     .|.....|:.|::        :||.:||:||.:..
  Fly   310 SVLEKLLKV---------------------DKKVATVMAMDML--------MAGVDTTSSTFTAL 345

  Fly   327 LYELTQNPEVMEKAKEDVRSAIEKHGGKLTYDAISDMKYLEACILETARKYPALPLLNRICTKD- 390
            |..|.:|||...:.:|:|...:.....:.|..::.::.||.|||.|:.|.||.:....|..|:| 
  Fly   346 LLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDS 410

  Fly   391 ----YPVPDSKLVIQKGTPIIISLIGMHR--DEEYFPDPLAYKPERYLENGKD------------ 437
                |.||       .||  |:|:|.::.  .|||||.|..:.|||:|.|..|            
  Fly   411 VISGYRVP-------AGT--IVSMIPINSLYSEEYFPKPTEFLPERWLRNASDSAGKCPANDLKT 466

  Fly   438 YTQAAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLEI-RKEKCEIEFGVYGIPLMP 496
            .....:||||.|||||:|.|:.::.:::..|:::.||::|. ...|......:..:|.:|
  Fly   467 KNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNHSTKNAFRSALINLPNIP 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 104/429 (24%)
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 107/449 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.