DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d5 and CYP705A28

DIOPT Version :9

Sequence 1:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:325 Identity:79/325 - (24%)
Similarity:146/325 - (44%) Gaps:55/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 ATTIFGLDVDSFA-DPNNEFQII----SKKVNRNNIEDIIRGTSSFLYPGLEKFFVKIGWKQEAT 243
            |..:.||.::|.| .|.....:|    .||:..:..:..|:..|......||||.|      |..
plant    14 AERVRGLVIESLALSPKIFLGMIFHKPLKKLGISLFQKDIKSVSPKFDELLEKFLV------EHE 72

  Fly   244 ERMRELSNRTVDLREQNNIVRKDLLQLLLQLRNQGKINTDDNIWSAESTK--------NGVKSMS 300
            |:|           |:::....|::.|||:.......|.:..|....:||        ...|..:
plant    73 EKM-----------EEDHYKANDMMDLLLEAMEMRMQNVNLCIKRVSNTKARKPPILFRYGKYSN 126

  Fly   301 KDLIAGQLFLFYVAGYETTASTTSFTLYELTQNPEVMEKAKEDVRSAIEKHGGKLTYDA-ISDMK 364
            ..|:..:|.   |||.:|:|..|.:|:.||..||.::|:.:|::.|.:  ...:|..:. :|::.
plant   127 NSLLLQELL---VAGTDTSALATQWTMAELINNPTILERLREEIESVV--GNTRLIQETDLSNLP 186

  Fly   365 YLEACILETARKYPALPLLNRICTK-----DYPVPDSKLVIQKGTPIIISLIGMHRDEEYFPDPL 424
            ||::.:.|..|.:|...:..|:..:     .:.:|:..|       ::::...:.||..::.||.
plant   187 YLQSVVKEGLRLHPPASISVRMSQERCELGGFYIPEKTL-------LVVNTYAIMRDPNFWEDPE 244

  Fly   425 AYKPERYLENGKDYTQ-------AAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLEIRKEK 482
            .:||||::.:.:...:       ..|:||..|.|.|.|:.:..|::.|||..::..||..|:.||
plant   245 EFKPERFITSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIGVMVQCFDWRIKGEK 309

  Fly   483  482
            plant   310  309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 76/319 (24%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 79/325 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.