DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d5 and Cyp4d21

DIOPT Version :10

Sequence 1:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster


Alignment Length:67 Identity:16/67 - (23%)
Similarity:30/67 - (44%) Gaps:12/67 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELQVNPILDALNNAFDEFSRVVKARPSLTTAVIVENIREELIGFVNVI--TMQMNTGNVTGLVNH 77
            :|||......|...||:|   |::..||..|:       :.|.::.::  ...:....|||:..|
  Fly   209 DLQVTSAFTYLELRFDKF---VRSAASLVYAL-------QCIIYIPIVIYVPALAFSQVTGVNLH 263

  Fly    78 LL 79
            ::
  Fly   264 VI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d5NP_650327.1 CYP6-like 63..501 CDD:410679 4/17 (24%)
Cyp4d21NP_609129.2 CYP4 68..502 CDD:410721 16/67 (24%)

Return to query results.
Submit another query.