DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d5 and Cyp12d1-p

DIOPT Version :9

Sequence 1:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster


Alignment Length:394 Identity:107/394 - (27%)
Similarity:180/394 - (45%) Gaps:65/394 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LFQMEGASWRALRNKLTPSFTSGK-LKAMFETSDSVGDKLVDSIRKQLPANGAKELELKKLMATY 178
            |...:..:|..||:.:.|.|...: |:..:|...::.::.::.|::   ....|.||:.:...  
  Fly   140 LVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFIERIKE---IRDPKTLEVPEDFT-- 199

  Fly   179 AIDIIATTIF-GLDVDSFADPNNEFQIISKKVNRNNIE---------DIIRGTSSF-LYPGLEKF 232
              |.|:..:| .|.:.:|   :.:..:|.|  ||:|.:         ||.|.|... :.|.:   
  Fly   200 --DEISRLVFESLGLVAF---DRQMGLIRK--NRDNSDALTLFQTSRDIFRLTFKLDIQPSM--- 254

  Fly   233 FVKIGWKQEATERMRELSNRTVDLREQNNIVRKDLL--QLLLQLRNQG--KINTDDNIWS-AEST 292
                 ||..:|...|:: .||  |.:..|:.:|.|.  |..|:.|.|.  |||::..:.. .|..
  Fly   255 -----WKIISTPTYRKM-KRT--LNDSLNVAQKMLKENQDALEKRRQAGEKINSNSMLERLMEID 311

  Fly   293 KNGVKSMSKDLIAGQLFLFYVAGYETTASTTSFTLYELTQNPEVMEKAKEDVRSAIEKHGGKLTY 357
            ......||.|::        .||.:.||:..|..|..|:::|:...|.:|::.|.:......|..
  Fly   312 PKVAVIMSLDIL--------FAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNE 368

  Fly   358 DAISDMKYLEACILETARKYPALPLLNRICTKD-----YPVPDSKLVIQKGTPIIISLIGMHRDE 417
            :.:.||.||.|.|.||.|.||......|.|..|     |.||       |||.:::....:.::.
  Fly   369 ENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRVP-------KGTTVLLGSNVLMKEA 426

  Fly   418 EYFPDPLAYKPERYL---ENGK--DYTQAAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLE 477
            .|:|.|..:.|||:|   |.||  ..:...:||||.|||||||.|:..:.::..:||::.||.:|
  Fly   427 TYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVE 491

  Fly   478 IRKE 481
            ..::
  Fly   492 FNRD 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 106/389 (27%)
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 107/394 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.