DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d5 and cest-32

DIOPT Version :9

Sequence 1:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:369 Identity:73/369 - (19%)
Similarity:118/369 - (31%) Gaps:123/369 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFPSTGVSIPFG---------ALESVTKGKRSFG--MAIYDMYKSTKEPVIGLYLTLRPALLVRD 82
            ||.:||..:..|         ||:.|.:..:|||  ..|..:..::...|....|.|.|    ..
 Worm   164 GFMTTGDEVSRGNYGLWDQTLALKWVQEHIKSFGGNPNIVTVCGTSAGGVSAGLLALSP----HS 224

  Fly    83 AQLAHDVLVKDFASFHDRGVYVDEKNDPMSASLFQMEGASWRALRNKLTPSFTSGKLKAMFETSD 147
            .:|.|..:....::|.:..:...|:...:..:..:..|                      :|..|
 Worm   225 NKLFHRFMAMSGSAFCEFSIRTKEQEAEIFRNFAKHHG----------------------YEGED 267

  Fly   148 SVGDKLVDSIRKQLPANGAKELELKKLMATYAIDIIA----TTIFGLDVDSFADPNNEFQIISKK 208
            |  :.|::..:.|         .|.|...|...:..|    |.|...|.|.|..|.:|....:.|
 Worm   268 S--ESLLEWYKSQ---------PLSKFQETATFEKKASGFLTFIPNFDGDFFPKPFDELSREAPK 321

  Fly   209 V-------------------NRNNIEDIIRGTSSFLYPGLEKFFVKIGWKQEATERMRELSNRTV 254
            :                   :|.|..|||:  |||....:|.       ..:..:|:.|...:.:
 Worm   322 LDAMATVDEYEGLGFLTMFQSRRNDMDIIK--SSFGSDVVEN-------AVDVQKRIMEFYMKNI 377

  Fly   255 DLREQNNIVRKDLLQLLLQLRNQGKINTDD--NIWSAESTKNGVKSMSKDLIAGQLFLFYVAGYE 317
            | :..:..|.|.|:||:          :|.  ||.:.|:.|...|                  |.
 Worm   378 D-KNDDKAVEKRLIQLI----------SDSWFNIGALETVKTSTK------------------YG 413

  Fly   318 TTASTTSFTLYELTQNPEVME----KAKEDVRSAIEKHGGKLTY 357
            :.|...||..|.:..|.....    ||        ..||.:|.|
 Worm   414 SNAYLGSFDYYNMGSNDPYATWFPFKA--------ANHGSELKY 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 61/321 (19%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 73/369 (20%)
Aes <104..>227 CDD:223730 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.