DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and ENC1

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_003624.1 Gene:ENC1 / 8507 HGNCID:3345 Length:589 Species:Homo sapiens


Alignment Length:200 Identity:58/200 - (28%)
Similarity:88/200 - (44%) Gaps:19/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 SGQSNIVQF---KVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHE 687
            ||..||..|   ...:..|:. |..|.....|:||.|..|.|.|..|:|:|||.|..|.|||...
Human    15 SGSINIYLFHKSSYADSVLTH-LNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGG 78

  Fly   688 MEERKLNRVAITDVDH-EVLKEMLRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVN 751
            ::|.:.:.|...:..| |||:.:|.:.|:.:....|:.|:.||.|.|....:.::..|.|.|..|
Human    79 LKESQDSEVNFDNSIHPEVLELLLDYAYSSRVIINEENAESLLEAGDMLEFQDIRDACAEFLEKN 143

  Fly   752 LSVETAAETLILADLHSADQL----------KAQTI----DFINTHATDVMETSGWQNMITTHSH 802
            |........|:|:|.|...:|          ..|||    ||:......|::....:.:.|....
Human   144 LHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDER 208

  Fly   803 LIAEA 807
            |:.|:
Human   209 LVYES 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB_POZ_roadkill-like 637..757 CDD:349654 39/120 (33%)
BACK_roadkill_like 752..825 CDD:350595 15/69 (22%)
ENC1NP_003624.1 BTB_POZ_KLHL37_ENC1 6..152 CDD:349576 44/137 (32%)
PHA03098 48..566 CDD:222983 48/165 (29%)
BACK_KLHL37_ENC1 145..242 CDD:350590 14/68 (21%)
Kelch 1 296..340
KELCH repeat 330..374 CDD:276965
Kelch 2 341..388
KELCH repeat 378..431 CDD:276965
Kelch 3 389..444
KELCH repeat 434..480 CDD:276965
Kelch 4 446..492
Kelch 5 494..538
KELCH repeat 528..568 CDD:276965
Kelch 6 539..585
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.