DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT1G69660

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_177124.1 Gene:AT1G69660 / 843302 AraportID:AT1G69660 Length:231 Species:Arabidopsis thaliana


Alignment Length:174 Identity:45/174 - (25%)
Similarity:71/174 - (40%) Gaps:43/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 SPPLPEVNTPVAENWCYTQVKVVKF-------SYMWTINNFSFCREEMGEVLKSSTFSAGANDKL 520
            :|||        .||     :::.|       .:.|.:.|||..:|   :|..|:.:..|..:  
plant    77 APPL--------TNW-----EILSFDEKLSPPKFSWNLKNFSELKE---DVYTSNKYPMGGKE-- 123

  Fly   521 KWCLRVNPKGLDEESKDYLSLYLLLVSCN--KSEVRAKFK---FSILNAKREETKAMESQRAYRF 580
             |.|::.|||.......|||||:.|....  ||:.: .||   ..:||........::|...|: 
plant   124 -WVLKLYPKGNSRADGKYLSLYVHLADSETLKSDEK-NFKQGHVRVLNPLGSNHVEVQSSCWYK- 185

  Fly   581 VQGKDWGFKKFIR----RDFLLDEANGLLPEDKLTIFCEVSVVA 620
            ...:.||:..|:.    |...||:      ||.|.:..|..||:
plant   186 ESSRGWGWDHFLSIANLRKTYLDK------EDALNVEIEFKVVS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 40/154 (26%)
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
AT1G69660NP_177124.1 MATH 95..220 CDD:238068 37/138 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.