DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT1G65150

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_176694.1 Gene:AT1G65150 / 842822 AraportID:AT1G65150 Length:296 Species:Arabidopsis thaliana


Alignment Length:108 Identity:30/108 - (27%)
Similarity:51/108 - (47%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 EVLKSSTFSAGANDKLKWCLRVNPKGLD-EESKDYLSLYLLLVSCNKS-----EVRAKFKFSILN 563
            |..:|..||:||::   |.|.|:|||.: :....::|:|   |.|..|     :|.|...|.:.:
plant    32 EKYESPPFSSGAHN---WRLVVHPKGNEADNGSGFVSMY---VECLSSTTPPIDVFAYLTFFVFS 90

  Fly   564 AKREETKAMESQRAYRFVQGKD-WGFKKFIRRDFLLDEANGLL 605
            .:.::..:.:.....||...|. ||..|.:..:.|.|.|.|.:
plant    91 EEEKKYLSFQDVEVKRFNSSKTVWGLSKALPVETLKDRAKGFI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 30/108 (28%)
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
AT1G65150NP_176694.1 MATH 22..130 CDD:238068 28/103 (27%)
MATH 162..287 CDD:238068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.