DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT1G65050

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001319323.1 Gene:AT1G65050 / 842813 AraportID:AT1G65050 Length:162 Species:Arabidopsis thaliana


Alignment Length:166 Identity:36/166 - (21%)
Similarity:59/166 - (35%) Gaps:56/166 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 KSSTFSAGANDKLKWCLRVNPKGLD-EESKDYLSLYLLLVSCNKS-----EVRAKFKFSILNAKR 566
            :|..||:|.::   |.|.|.|||.: :..:.::|:|   |.|..|     :|.....|.:.:.:.
plant    35 ESPPFSSGGHN---WRLVVYPKGNEADNGRGFVSMY---VECLSSTTPPIDVFVYLTFFVFSEEE 93

  Fly   567 EETKAMESQRAYRFVQGKD-WGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSN 630
            :...:::.....||...|. ||..:.:..:.|.|.|.|.:                         
plant    94 KRYLSIQDVEVKRFNSSKTVWGLSQVLPVETLKDRAKGFI------------------------- 133

  Fly   631 IVQFKVPECKLSEDLGNLFDNE----KFSDVTLSVG 662
                          |..||.|.    |||..|.|:|
plant   134 --------------LSRLFHNPPLLVKFSLFTNSLG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 26/119 (22%)
BTB_POZ_roadkill-like 637..757 CDD:349654 10/30 (33%)
BACK_roadkill_like 752..825 CDD:350595
AT1G65050NP_001319323.1 MATH 27..130 CDD:238068 24/100 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.