DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and ZW9

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_564729.1 Gene:ZW9 / 842196 AraportID:AT1G58270 Length:396 Species:Arabidopsis thaliana


Alignment Length:161 Identity:40/161 - (24%)
Similarity:71/161 - (44%) Gaps:14/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 ENW-CYTQVKVVKFS-YMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKD 537
            ||| .::..:.::.. :.|.:..||   ....:...|.:||:|..:   |.|:|.|.|:...:.:
plant   238 ENWEVFSNEQNIRDPIFEWRLTKFS---TRFLDSYTSDSFSSGGRN---WALKVYPNGVGNATGN 296

  Fly   538 YLSLYLLLVSCN-KSEVRAKFK-FSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDE 600
            .||||||....| |..|.||.: ...:.:...|.|.    .|:.......|||.:|:....:.:.
plant   297 SLSLYLLSDQSNDKGYVEAKLRVIDQIQSNNFEKKV----AAWPNATENGWGFDRFLSFADIKNT 357

  Fly   601 ANGLLPEDKLTIFCEVSVVADSVNISGQSNI 631
            :.|.|..|.|.:..::...:.:...|.||::
plant   358 SKGFLVNDTLKLEVQILSFSKTDYYSHQSSL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 34/140 (24%)
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
ZW9NP_564729.1 MATH 112..231 CDD:238068
MATH 254..373 CDD:238068 34/128 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.