DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT1G55760

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_175972.1 Gene:AT1G55760 / 842025 AraportID:AT1G55760 Length:329 Species:Arabidopsis thaliana


Alignment Length:311 Identity:79/311 - (25%)
Similarity:132/311 - (42%) Gaps:58/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 WTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCNKSEVR- 554
            |.|:|.|     .....||..|..|.   ..|.|.|      |:||..|::.|.....|.:... 
plant    17 WRIHNLS-----SSTYRKSDPFKMGL---WNWHLSV------EKSKMLLNVKLYPEVSNLTRENP 67

  Fly   555 --AKFKFSILNAKREETKAMESQRAY--RFVQGKD--WGF------KKFIRRDFL----LDEANG 603
              |.|...::::..|. ||:......  |....:|  |..      |..|..:||    |.:.:|
plant    68 PVASFALRVVSSTGER-KALSHPEVIDKRIKTNEDFIWTIEVPLTGKIIIDVEFLDLKVLSQDSG 131

  Fly   604 LLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQA 668
            .|          .|:.|:. :...||.:...        ..||.:.....::|:|::.......|
plant   132 EL----------YSIWANG-STENQSQVTAV--------TSLGRMLTESIYTDITINASDGSIGA 177

  Fly   669 HKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPN----LEKMADDLL 729
            |:|:|||||.||.:||.|:::|::|:.:.:.|:..:..:..|.:|| |...|    :.::|  ||
plant   178 HRAVLAARSPVFRSMFLHDLKEKELSEINVLDMPLDACQAFLSYIY-GNIQNEDFLIHRLA--LL 239

  Fly   730 AAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFI 780
            .||:||.:..||..|..:|..::..:...|.|..|.|:...:|||..:.::
plant   240 QAAEKYDIADLKEACHLSLLDDIDTKNVLERLQNAYLYQLPELKASCMRYL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 33/146 (23%)
BTB 645..749 CDD:279045 35/107 (33%)
BTB 656..752 CDD:197585 34/99 (34%)
SPOP_C 752..814 CDD:269807 7/29 (24%)
AT1G55760NP_175972.1 BTB 154..255 CDD:279045 34/103 (33%)
BTB 165..262 CDD:197585 34/99 (34%)
BACK_like 262..318 CDD:297737 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.