DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT1G31380

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_174423.1 Gene:AT1G31380 / 840028 AraportID:AT1G31380 Length:175 Species:Arabidopsis thaliana


Alignment Length:142 Identity:34/142 - (23%)
Similarity:63/142 - (44%) Gaps:40/142 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 LLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSV 661
            |||:..|.:...::.|..||.|    :.:.|:|:::                   |:.|.|..|:
plant     7 LLDKNGGFMVNGEVKIVAEVGV----LEVVGKSDVL-------------------EETSLVMESM 48

  Fly   662 GGREFQAHKAILAARSDVFAAMFE-HEMEERKLN----RVAITDVDHEV-LKEMLRFIYTGKAPN 720
            ....||    :|.::.:...::|| |...|.||:    .:.||.::..: |.|:|     .::| 
plant    49 YVNGFQ----VLPSQVEFVKSLFEKHPDIESKLHLKNPHMRITYLNSLLTLTEIL-----SQSP- 103

  Fly   721 LEKMADDLLAAA 732
             |.:::|.||.|
plant   104 -ENISNDDLANA 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 8/23 (35%)
BTB_POZ_roadkill-like 637..757 CDD:349654 24/102 (24%)
BACK_roadkill_like 752..825 CDD:350595
AT1G31380NP_174423.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.