DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT1G31370

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_174422.1 Gene:AT1G31370 / 840027 AraportID:AT1G31370 Length:193 Species:Arabidopsis thaliana


Alignment Length:127 Identity:27/127 - (21%)
Similarity:52/127 - (40%) Gaps:42/127 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 AKREETKAMESQRAYRFVQGKD----W--------------GFKKFIRRDFLLDEANGLLPEDKL 610
            |||.|...:.:.:..::.:.:|    |              ||:..:..:.|||...|.:...::
plant    18 AKRRELTPLRNTKRQKYGERQDTNASWLSDDRTIKPKLPSCGFRSMLPLNELLDVNGGFMVNGEV 82

  Fly   611 TIFCEV---------------SVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDV 657
            .|..||               |:|.:|::::|      |:|...:: |.:.:||  ||..|:
plant    83 KIVAEVGVLEVVRKSDVLVETSLVMESIDVNG------FQVLPSQV-ESVKSLF--EKHPDI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 17/89 (19%)
BTB_POZ_roadkill-like 637..757 CDD:349654 6/21 (29%)
BACK_roadkill_like 752..825 CDD:350595
AT1G31370NP_174422.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.