DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT1G21780

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001077574.1 Gene:AT1G21780 / 838782 AraportID:AT1G21780 Length:326 Species:Arabidopsis thaliana


Alignment Length:318 Identity:82/318 - (25%)
Similarity:126/318 - (39%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 TQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLL 544
            |:|:.:.....|.|.||..|     ...||..|..|.   ..|.|.:       |...|||:.|.
plant     4 TKVETISRLAQWRIENFGPC-----SFKKSDPFKVGI---WNWHLSI-------ERNRYLSVRLF 53

  Fly   545 ----LVSCNKSEVRAKFKFSILNA--KREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLD---- 599
                .||..:..| |||...:.|.  .|....:...::..|......|.........|.:|    
plant    54 PELSRVSKEQPPV-AKFVLRVSNVGPNRRFYISPVYEKLLRTTDDCVWHVDSSFHGRFTIDVEFL 117

  Fly   600 ----------EANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKF 654
                      ||:.:.|.|           |...:||.|:.:      :|     |..:.:....
plant   118 DLKICPVNGGEASPVWPTD-----------ATMQSISTQTTL------KC-----LSRMLEESIL 160

  Fly   655 SDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAP 719
            :||.:........||||||:|.|.||.:||.|::.|::.:.:.|.|:..|....:|.::| |...
plant   161 TDVIIHTADGTLSAHKAILSASSTVFKSMFHHDLMEKESSTIHIDDMSRESCMALLSYLY-GNIT 224

  Fly   720 NLE----KMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLK 773
            ..|    ::|  ||.||:||.:..||..|||:|..:::.....|.|..|.|:..::||
plant   225 QEEFWKHRLA--LLGAANKYDITDLKAACEESLMEDINSSNVLERLQEAWLYQLEKLK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 32/157 (20%)
BTB 645..749 CDD:279045 36/107 (34%)
BTB 656..752 CDD:197585 36/99 (36%)
SPOP_C 752..814 CDD:269807 6/22 (27%)
AT1G21780NP_001077574.1 BTB 151..255 CDD:395526 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.