DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT5G26290

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001318656.1 Gene:AT5G26290 / 832698 AraportID:AT5G26290 Length:336 Species:Arabidopsis thaliana


Alignment Length:176 Identity:41/176 - (23%)
Similarity:71/176 - (40%) Gaps:19/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 TINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEE-SKDYLSLYLLLVSCNKS---- 551
            :|.:||..|.. .|..:||.|.|..   .||.|.:...|.::: .||::|||..:|.....    
plant    58 SITSFSIIRTR-PEPYESSVFEAVG---YKWRLVLYVNGNEKDGGKDHVSLYAKIVETESLPVGW 118

  Fly   552 EVRAKFKFSILNAKREETKAMESQRAYRFVQG-KDWGFKKFIRRDFLLDEANGLLPEDKLTIFCE 615
            ||....|..:.|.|..:...:......|:... |:.|:.:.|.:....|..:|...:|..|...|
plant   119 EVNVDLKLFVYNGKLNKYLIVTDGTVKRYNNATKELGYGQLIPQSTFYDGNDGYREQDTGTFGAE 183

  Fly   616 VSVVADSVN------ISG-QSNIVQFKVPECKLSEDLGNLFDNEKF 654
            :.:|..:..      ||. ..|:..:|:......||  .::.:.:|
plant   184 IYIVKPAQQKEKVTFISNPPDNVFTWKILHFSTLED--KVYQSNEF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 34/134 (25%)
BTB_POZ_roadkill-like 637..757 CDD:349654 3/18 (17%)
BACK_roadkill_like 752..825 CDD:350595
AT5G26290NP_001318656.1 MATH 56..184 CDD:238068 32/129 (25%)
MATH 207..325 CDD:238068 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.