DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT5G26260

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_568483.1 Gene:AT5G26260 / 832695 AraportID:AT5G26260 Length:351 Species:Arabidopsis thaliana


Alignment Length:269 Identity:62/269 - (23%)
Similarity:94/269 - (34%) Gaps:84/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 VTSNLHASSSTMAVSRVPSPPLPEVNTPVAENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKS 509
            :||||..::..:...|..|                   |:|      ||.:||..::. ||..:|
plant    44 LTSNLGVTTRELRDERPSS-------------------KIV------TITSFSVIKDR-GEPYES 82

  Fly   510 STFSAGANDKLKWCL----RVNPKGLDEESKDYLSLYLLLVSCNKS----EVRAKFKFSILNAKR 566
            |.|.|..   .||.|    :.||||   ...:::|||..:......    ||....|..:.|.|.
plant    83 SIFEAAG---YKWRLVLYVKGNPKG---GINNHISLYARIEETETLPRGWEVNVDLKLFVHNRKL 141

  Fly   567 EETKAMESQRAYRFVQG-KDWGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSN 630
            ::..::......|:... |:|||.:.|......:...|.|.:|..:...|:.:    ||.:.:..
plant   142 KKYLSVTDGTVKRYNDAKKEWGFTQLISLPTFYNANEGYLVQDTASFGAEIFI----VNPTEKQE 202

  Fly   631 IVQFKVPECKLSEDLGNLF-----------DNEKFSDVTL--------------SVGGREF---- 666
            .|.|      :|....|:|           |...:||..|              |.|||..    
plant   203 KVTF------ISNPPDNVFTWKILRFSTLEDKFYYSDDFLVGDRYWRLGFNPKGSGGGRPHALPI 261

  Fly   667 ----QAHKA 671
                |.|||
plant   262 FLYAQGHKA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 37/146 (25%)
BTB_POZ_roadkill-like 637..757 CDD:349654 15/68 (22%)
BACK_roadkill_like 752..825 CDD:350595
AT5G26260NP_568483.1 MATH 67..194 CDD:425944 34/133 (26%)
MATH 215..340 CDD:238068 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.