DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and BPM5

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_197600.1 Gene:BPM5 / 832225 AraportID:AT5G21010 Length:410 Species:Arabidopsis thaliana


Alignment Length:357 Identity:109/357 - (30%)
Similarity:179/357 - (50%) Gaps:48/357 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 KVVKFSYMWTINNFSFCR-EEMGEVLKSSTFSAGANDKLKWCLRVNPKGLD-EESKDYLSLYLLL 545
            :.|..|:.:.|..:|..: ..:|:.:.|..||.|.   .:|.:...|.|.: |::..|:|:::.|
plant    25 QTVNGSHQFVIQGYSLAKGMGIGKHIASDNFSVGG---YQWGIFFYPDGKNPEDNSSYVSVFIAL 86

  Fly   546 VSCNKSEVRAKFKFSILNAKREETKAMES--QRA---------YRFVQGKDWGFKKFIRRDFLLD 599
            .| ..:||||.|:.::::...:....:.|  :|:         ||   |..||:|:|.||..|  
plant    87 AS-EGTEVRALFELALVDQSGKGKHKVHSHFERSLDGGPYTLKYR---GSMWGYKRFFRRSIL-- 145

  Fly   600 EANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGR 664
            |.:..|.:|.|.|.|.|.||...: :..|.:.|.  ||:.:|....|.|.|:.:.||:|.::.|.
plant   146 ETSDYLKDDCLIINCTVGVVVSEI-LCPQLHSVH--VPDSELGSHFGVLLDSMEGSDITFNIAGE 207

  Fly   665 EFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPN--------- 720
            :|.|||.:|||||..|.:.|..|.|... ..|.|.|::.:|.|.:|:|:|....|.         
plant   208 KFLAHKLVLAARSPFFKSKFFSEFEANN-TEVTINDLEPKVFKALLQFMYKDSLPEDVEPATAHT 271

  Fly   721 ---------LEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQT 776
                     .|.:...:|||||||.|.:|:::||..:|..:||::.|:.|.|||.::|.:||...
plant   272 FERLKLSEIYETLIVKVLAAADKYDLIRLRLLCESHICKGVSVKSVAKILALADRYNAKELKGVC 336

  Fly   777 IDFINTHATDVMETSGWQNM----ITTHSHLI 804
            :.|...:...|:||..:|.|    :|..|.|:
plant   337 LKFTAENLAAVLETDAYQQMKDECVTLQSELL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 43/150 (29%)
BTB 645..749 CDD:279045 41/121 (34%)
BTB 656..752 CDD:197585 38/113 (34%)
SPOP_C 752..814 CDD:269807 19/57 (33%)
BPM5NP_197600.1 MATH 29..162 CDD:238068 39/141 (28%)
BTB_POZ_BPM_plant 184..309 CDD:349589 42/125 (34%)
BACK_AtBPM-like 309..370 CDD:350516 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2843
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2651
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.