DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and ARIA

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_850852.1 Gene:ARIA / 832053 AraportID:AT5G19330 Length:710 Species:Arabidopsis thaliana


Alignment Length:230 Identity:72/230 - (31%)
Similarity:112/230 - (48%) Gaps:24/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   589 KKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQ--------FKVPECKLSED- 644
            :|.|:|...|..|:...|||:.|||.:.:.:...:.:.|..|..|        :|:....::.. 
plant   452 EKSIQRRVALALAHLCSPEDQRTIFIDDNGLELLLGLLGSLNTKQQLDGAAALYKLANKSMALSP 516

  Fly   645 -------------LGNLF-DNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNR 695
                         ||..: :|...||||..|.||.|.||:..|.|.||.|.|||:....|:....
plant   517 VDAAPPSPTQRVYLGEQYVNNATLSDVTFLVEGRTFYAHRICLLASSDAFRAMFDGGYREKDARD 581

  Fly   696 VAITDVDHEVLKEMLRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAET 760
            :.|.::..||.:.|:||||||......:::.|||.|||:|.||.||.:||..:..::::|:..:.
plant   582 IEIPNIKWEVFELMMRFIYTGSVDITNEISKDLLRAADQYLLEGLKRLCEYTIAQDITLESIGDM 646

  Fly   761 LILADLHSADQLKAQTIDFINTHATDVMETSGWQN 795
            ..|::...|..|:...|.||..| .|.:.:..|||
plant   647 YELSEAFHAMSLRQACIMFILEH-FDKLSSMPWQN 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 11/31 (35%)
BTB_POZ_roadkill-like 637..757 CDD:349654 46/134 (34%)
BACK_roadkill_like 752..825 CDD:350595 12/44 (27%)
ARIANP_850852.1 PLN03200 121..>353 CDD:215629
armadillo repeat 144..183 CDD:293788
armadillo repeat 194..225 CDD:293788
armadillo repeat 233..269 CDD:293788
armadillo repeat 275..306 CDD:293788
armadillo repeat 317..351 CDD:293788
BTB_POZ_ARIA_plant 528..643 CDD:349661 46/114 (40%)
BACK_ARIA_like 637..700 CDD:350579 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.