DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and ABAP1

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_196810.5 Gene:ABAP1 / 831145 AraportID:AT5G13060 Length:737 Species:Arabidopsis thaliana


Alignment Length:176 Identity:61/176 - (34%)
Similarity:87/176 - (49%) Gaps:16/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   645 LGNLF-DNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKE 708
            ||..| :|...||||..:.|::|.|||..|.|.||:|.|||:...:||....|.|.::..||.:.
plant   557 LGEKFVNNPTMSDVTFLIDGKQFYAHKIGLVASSDIFRAMFDGLYKERNAQNVEIPNIRWEVFEL 621

  Fly   709 MLRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLK 773
            |::|||:|:....:.:|.|||.|||:|.||.||..||..:...:.::...|...|||..:|..|:
plant   622 MMKFIYSGRINIAKHLAKDLLVAADQYLLEGLKRQCEYTIAQEICLDNIPEMYELADTFNASALR 686

  Fly   774 AQTIDFINTHATDVMETSGWQNMITTHSHLIAEAFRALATQQIPPI 819
            .....|:..|.|. :.:..|              |.....|.||.|
plant   687 RACTLFVLEHFTK-LSSQLW--------------FAKFVKQIIPEI 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB_POZ_roadkill-like 637..757 CDD:349654 46/112 (41%)
BACK_roadkill_like 752..825 CDD:350595 15/68 (22%)
ABAP1NP_196810.5 SRP1 17..440 CDD:227396
armadillo repeat 117..160 CDD:293788
armadillo repeat 221..252 CDD:293788
armadillo repeat 260..296 CDD:293788
armadillo repeat 302..333 CDD:293788
armadillo repeat 344..378 CDD:293788
armadillo repeat 385..416 CDD:293788
HEAT repeat 423..459 CDD:293787
armadillo repeat 500..534 CDD:293788
BTB_POZ_ARIA_plant 555..670 CDD:349661 46/112 (41%)
BACK 664..727 CDD:475122 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.