DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT4G09770

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001328032.1 Gene:AT4G09770 / 826565 AraportID:AT4G09770 Length:323 Species:Arabidopsis thaliana


Alignment Length:141 Identity:39/141 - (27%)
Similarity:68/141 - (48%) Gaps:17/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 YMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYL----LLVSCN 549
            :.|.|::||:..::  ....|..|..|  |: ||.|:::|||  ::....||:|:    .|.:..
plant   187 FTWKISHFSYIGDK--RYYYSDEFVVG--DR-KWRLKISPKG--DKKVRALSVYVQAMAYLPNAV 244

  Fly   550 KSEVRAKFKFSILNAKREETKAMESQRAYRFV---QGKDWGFKKFIRRDFLLDEANGLLPEDKLT 611
            .|...||.:..:||.|  .:..:| :|.:.|.   .|...|..:.|..:.|.||:.|.|.||.:.
plant   245 ASSTYAKLRLRLLNQK--NSNHIE-KRVFHFYSRENGDGSGISELISVEDLNDESKGYLVEDSIV 306

  Fly   612 IFCEVSVVADS 622
            :...:..|:|:
plant   307 LETTLLWVSDT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 38/138 (28%)
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
AT4G09770NP_001328032.1 MATH 37..164 CDD:238068
MATH 185..308 CDD:238068 37/130 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.